PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00039.1_g00046.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 319aa    MW: 35775.1 Da    PI: 8.9947
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00039.1_g00046.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.62.4e-53131391128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+e+d+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkat
  Rsa1.0_00039.1_g00046.1  13 LPPGFRFHPTDEELVVHYLKKKAASIPLPV-SIIAEIDLYKFDPWELPSKASFGEQEWYFFSPRDRKYPNGVRPNRAATSGYWKAT 97 
                              79****************************.89***************988899******************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk++++ ++++vg+kk Lvfy g+ pkg ktdW+mheyrl
  Rsa1.0_00039.1_g00046.1  98 GTDKPIFTCNSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRL 139
                              ****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-647175IPR003441NAC domain
PROSITE profilePS5100560.64713174IPR003441NAC domain
PfamPF023651.3E-2714139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGDSTIGPGH PHLPPGFRFH PTDEELVVHY LKKKAASIPL PVSIIAEIDL YKFDPWELPS  60
KASFGEQEWY FFSPRDRKYP NGVRPNRAAT SGYWKATGTD KPIFTCNSHK VGVKKALVFY  120
GGKPPKGIKT DWIMHEYRLT DGNLNTAAKP PDSTTSRKNS LRLDDWVLCR IYKKNSSQRP  180
TMERVLLRED LMEGMLSKSS ANSSSTSVLD NNNNNNNNEE HFFDGMAVSS DKRSLCGQYR  240
IGHEATGSSS FGSFLSSKRF HHTSDLNNDN YNVSFVSMLS EIPQSSGFHG NGVIDTTSTL  300
ADHGVLRQAF QLPNMNWHP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-741317717168NO APICAL MERISTEM PROTEIN
1ut4_B3e-741317717168NO APICAL MERISTEM PROTEIN
1ut7_A3e-741317717168NO APICAL MERISTEM PROTEIN
1ut7_B3e-741317717168NO APICAL MERISTEM PROTEIN
3swm_A3e-741317720171NAC domain-containing protein 19
3swm_B3e-741317720171NAC domain-containing protein 19
3swm_C3e-741317720171NAC domain-containing protein 19
3swm_D3e-741317720171NAC domain-containing protein 19
3swp_A3e-741317720171NAC domain-containing protein 19
3swp_B3e-741317720171NAC domain-containing protein 19
3swp_C3e-741317720171NAC domain-containing protein 19
3swp_D3e-741317720171NAC domain-containing protein 19
4dul_A3e-741317717168NAC domain-containing protein 19
4dul_B3e-741317717168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747590.0KF974759.1 Brassica napus NAC transcription factor 25-1 (NAC25-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013614938.10.0PREDICTED: NAC transcription factor 25
SwissprotQ8GY420.0NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A078HQU30.0A0A078HQU3_BRANA; BnaCnng10130D protein
TrEMBLA0A0D2ZUJ00.0A0A0D2ZUJ0_BRAOL; Uncharacterized protein
STRINGBra027101.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.10.0NAC domain containing protein 25